} { }); "defaultAriaLabel" : "", LITHIUM.Dialog.options['-361463357'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); { }); { }, } "actions" : [ "componentId" : "forums.widget.message-view", "actions" : [ "context" : "", "event" : "addMessageUserEmailSubscription", "action" : "pulsate" ] "event" : "addThreadUserEmailSubscription", ] "event" : "deleteMessage", "revokeMode" : "true", "componentId" : "kudos.widget.button", { }, ', 'ajax'); { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); { "context" : "", "action" : "rerender" "message" : "1536574", }, LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); { "actions" : [ "event" : "kudoEntity", { "event" : "addThreadUserEmailSubscription", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "selector" : "#kudosButtonV2_7", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1536494,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } }, }, "context" : "envParam:selectedMessage", { "selector" : "#messageview_6", "disableKudosForAnonUser" : "false", "actions" : [ }, ] ] "action" : "rerender" "displayStyle" : "horizontal", //var height = $(window).scrollTop(); "initiatorBinding" : true, "}); "context" : "", ] } "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, } "context" : "", } { } { "action" : "rerender" "actions" : [ { } }, ], }, { ] }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "context" : "envParam:quiltName,expandedQuiltName", ] "disallowZeroCount" : "false", }, { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "editProductMessage", "selector" : "#kudosButtonV2_7", "action" : "rerender" } { { "accessibility" : false, ] } "disableLinks" : "false", "event" : "MessagesWidgetEditCommentForm", $(this).addClass('active') "event" : "RevokeSolutionAction", "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "messageViewOptions" : "1111110111111111111110111110100101001101" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { } "disableKudosForAnonUser" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] } "action" : "rerender" "event" : "MessagesWidgetMessageEdit", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" "actions" : [ LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); } "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "MessagesWidgetEditCommentForm", "parameters" : { aktuelles Modell umgestiegen ist. "action" : "rerender" ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1536574 .lia-rating-control-passive', '#form_5'); ] "context" : "", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "parameters" : { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); var keycodes = { }, { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'jKC3hPmauLfXK2otiG1aT57Otb1YYwJnlEfshHFrYJo. } "action" : "rerender" }, })(LITHIUM.jQuery); "event" : "AcceptSolutionAction", ] "actions" : [ { "event" : "AcceptSolutionAction", "context" : "", "action" : "pulsate" "displayStyle" : "horizontal", "truncateBody" : "true", "parameters" : { ] }, ] { return; ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "displaySubject" : "true", { { "event" : "QuickReply", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_31bab6a1ee3625","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_31bab6a1ee3625_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/193129&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IXqJIrRBIkZgzvKsOft12zz8jnhzGUHhpgtJrWw07_o. "actions" : [ "context" : "", { { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); }, "actions" : [ ] } "actions" : [ { { { { "parameters" : { "}); "context" : "lia-deleted-state", "action" : "rerender" })(LITHIUM.jQuery); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); { ] "event" : "MessagesWidgetAnswerForm", ] "event" : "QuickReply", ] "event" : "QuickReply", "actions" : [ ;(function($) { } } }, ] $('.lia-autocomplete-footer').append(ctaHTML); "context" : "", "actions" : [ "triggerEvent" : "click", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { "eventActions" : [ } "action" : "rerender" { } "action" : "rerender" "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetMessageEdit", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", { "disableLabelLinks" : "false", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'qnfKeZ6EpVgmo3_-t8DOS9EavV0_TREyG6-5foBxsjI. } }); "action" : "rerender" "event" : "expandMessage", "action" : "rerender" "showCountOnly" : "false", "context" : "", }, "context" : "", "event" : "removeThreadUserEmailSubscription", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233531}); "context" : "", ] // Oops, not the right sequence, lets restart from the top. "context" : "envParam:quiltName,message", ] } ', 'ajax'); if ( count == neededkeys.length ) { "actions" : [ "action" : "rerender" "action" : "rerender" ] "showCountOnly" : "false", ] "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditAction", } { { "event" : "QuickReply", element.siblings('li').find('ul').slideUp(); }, } "disableKudosForAnonUser" : "false", "message" : "1537772", } "action" : "rerender" ], "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "kudoEntity", "action" : "rerender" })(LITHIUM.jQuery); { ] "context" : "envParam:quiltName", ] "event" : "RevokeSolutionAction", "action" : "rerender" } "event" : "MessagesWidgetEditAction", "context" : "envParam:feedbackData", lithstudio: [], "context" : "", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); } { "context" : "", var key = e.keyCode; "parameters" : { }, ], "context" : "envParam:feedbackData", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/193129","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qH6imjKbMcxhvpC5IrWgPiUaRTK8kgOADyw966rzVxs. ] "context" : "envParam:entity", } { }, "eventActions" : [ { var id=ttIdealoAd('makepos','shl',1,'ideaload1660998953'); "context" : "envParam:selectedMessage", "action" : "rerender" { "useSimpleView" : "false", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); { } "action" : "rerender" "context" : "envParam:feedbackData", "disallowZeroCount" : "false", "disableKudosForAnonUser" : "false", "action" : "rerender" "action" : "rerender" } } { "event" : "MessagesWidgetEditAction", "linkDisabled" : "false" "action" : "rerender" ] "message" : "1536600", } }, watching = false; "action" : "rerender" { "context" : "", { "event" : "addMessageUserEmailSubscription", }, } "event" : "editProductMessage", "action" : "pulsate" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" { "event" : "unapproveMessage", "actions" : [ "actions" : [ "actions" : [ { } "action" : "rerender" count++; "event" : "MessagesWidgetCommentForm", "actions" : [ ] LITHIUM.AjaxSupport.ComponentEvents.set({ ] "event" : "ProductAnswer", LITHIUM.Dialog({ { "event" : "removeMessageUserEmailSubscription", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { { "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", } }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/193129","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BzBnZ8qtTWcn9qymnTFMPyZQkC6xGe-H5Db-B79jmGo. ] "actions" : [ "action" : "pulsate" } { { "actions" : [ "actions" : [ $(document).ready(function(){ "actions" : [ }); "event" : "deleteMessage", "event" : "ProductMessageEdit", "actions" : [ }, "actions" : [ { "event" : "ProductMessageEdit", ] }, }, "initiatorBinding" : true, "action" : "rerender" "event" : "unapproveMessage", { "event" : "deleteMessage", "action" : "addClassName" }, if ( count == neededkeys.length ) { { "context" : "", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "parameters" : { "truncateBodyRetainsHtml" : "false", ] "actions" : [ { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1538576,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "unapproveMessage", "action" : "pulsate" { { "actions" : [ "context" : "envParam:quiltName", { "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "messageViewOptions" : "1111110111111111111110111110100101001101" { "useCountToKudo" : "false", { { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { ], .attr('aria-expanded','true') "event" : "MessagesWidgetEditAction", "useSubjectIcons" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'n43rtX3yCUaRATE2MWrJ7zS7anIPs4yCb3mjHUYflYU. "actions" : [ { ] "context" : "envParam:feedbackData", }, } "context" : "", logmein: [76, 79, 71, 77, 69, 73, 78], })(LITHIUM.jQuery); "action" : "rerender" "event" : "markAsSpamWithoutRedirect", { "event" : "removeMessageUserEmailSubscription", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1538806 .lia-rating-control-passive', '#form_9'); ] } "context" : "", { } "disableLabelLinks" : "false", { { ] } { "linkDisabled" : "false" ', 'ajax'); "action" : "rerender" "disableLinks" : "false", { ] ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); ] "accessibility" : false, ] { "actions" : [ "event" : "ProductAnswer", "useTruncatedSubject" : "true", { { } "context" : "envParam:selectedMessage", "actions" : [ ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "useSubjectIcons" : "true", } "action" : "rerender" { "action" : "rerender" }, "linkDisabled" : "false"